4.78 Rating by CuteStat

wpgear.org is 1 decade 1 year old. It is a domain having org extension. It has a global traffic rank of #3830135 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, wpgear.org is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 220
Daily Pageviews: 440

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 7,580
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,830,135
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.30.252.153

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 7
H3 Headings: 2 H4 Headings: Not Applicable
H5 Headings: 19 H6 Headings: 3
Total IFRAMEs: 1 Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.30.252.153)

chris wanstrath: the official website

- chriswanstrath.com
3,912,436 $ 240.00

Site not found · GitHub Pages

- prss.me
Not Applicable $ 8.95

Skeleton: Responsive CSS Boilerplate

- getskeleton.com
232,436 $ 38,340.00

simurai

- simurai.com
3,628,594 $ 240.00

Site not found · GitHub Pages

- komodomedia.com
6,776,366 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Server: GitHub.com
Date: Fri, 13 Dec 2019 14:57:17 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Last-Modified: Wed, 25 Jul 2018 05:36:57 GMT
Vary: Accept-Encoding
ETag: W/"5b580c79-9274"
Access-Control-Allow-Origin: *
Expires: Fri, 13 Dec 2019 15:07:17 GMT
Cache-Control: max-age=600
Content-Encoding: gzip
X-Proxy-Cache: MISS
X-GitHub-Request-Id: C1D5:6E23:22887C:30B7AD:5DF3A6CD

Domain Nameserver Information

Host IP Address Country
ns.inwx.de 192.174.68.104 Austria Austria
ns2.inwx.de 176.97.158.104 Austria Austria
ns3.inwx.eu 45.87.158.53 Germany Germany
ns4.inwx.com 45.87.158.53 Germany Germany
ns5.inwx.net 45.87.158.53 Germany Germany

DNS Record Analysis

Host Type TTL Extra
wpgear.org A 3600 IP: 192.30.252.154
wpgear.org A 3600 IP: 192.30.252.153
wpgear.org NS 86400 Target: ns2.inwx.de
wpgear.org NS 86400 Target: ns3.inwx.eu
wpgear.org NS 86400 Target: ns4.inwx.com
wpgear.org NS 86400 Target: ns5.inwx.net
wpgear.org NS 86400 Target: ns.inwx.de
wpgear.org SOA 3600 MNAME: ns.inwx.de
RNAME: hostmaster.inwx.de
Serial: 2017021001
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum TTL: 3600

Similarly Ranked Websites

404 Not Found

- watchintenselyspeedythefile.vip
3,830,141 $ 240.00

Busty Galleries : 1000`s of Free Big tits, BBW, Mature, Ebony, Fat and

- bustygalleries.com

Busty Galleries Is Free Movie Site with fresh big tits, bbw, fat, mature, ebony and pregnant movie XXX galleries, daily updated

3,830,143 $ 240.00

The Tile & Stone Specialist | Lapicida

- lapicida.com

Lapicida is the leading specialist in luxury surfaces, supplying new and antique natural stone alongside ceramics, porcelains, quartz and manmade ‘sintered’ stone. Based in Yorkshire, we work with architects, interior designers, retailers and trade customers across the UK, Europe and the US.

3,830,146 $ 240.00


Weight Lose Quick

- weightlosequick.com

View the latest health news and explore articles on fitness, diet, nutrition, parenting, Weight loss,relationships, Cancer signs, medicine, diseases, and healthy living at weightlosequick.com Health.

3,830,149 $ 240.00

Full WHOIS Lookup

Domain Name: WPGEAR.ORG
Registry Domain ID: D167801373-LROR
Registrar WHOIS Server: https://www.inwx.de/de/domain/whois
Registrar URL: http://www.domrobot.com
Updated Date: 2019-05-05T21:38:56Z
Creation Date: 2013-02-05T16:59:56Z
Registry Expiry Date: 2022-02-05T16:59:56Z
Registrar Registration Expiration Date:
Registrar: INWX GmbH & Co. KG
Registrar IANA ID: 1420
Registrar Abuse Contact Email: abuse@inwx.com
Registrar Abuse Contact Phone: +49.3098321212
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Domain Robot Ltd.
Registrant State/Province:
Registrant Country: HK
Name Server: NS2.INWX.DE
Name Server: NS.INWX.DE
Name Server: NS3.INWX.EU
Name Server: NS4.INWX.COM
Name Server: NS5.INWX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2019-12-13T14:56:24Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.